데이터 상품 상세검색

[감염병연구]

폐질환·폐암(선암) 환자 의료 및 단백체 데이터

폐질환·폐암(선암) 환자 의료 및 단백체 데이터

  • 등록일2023-07-05
  • 조회수1118
  • 다운로드350
  • 카테고리감염병연구
  • 12

데이터 기본 이용료

  • 무료
상세정보
데이터등록일 데이터 수정일 데이터 이용기한 판매제공처
2023-07-05 2023-07-05 무기한 셀키
데이터 제공포맷 데이터 제공방식 데이터 파일용량 데이터 상품구분
csv/zip 다운로드 27.94 GB dataset

● 데이터 상품명 폐질환·폐암(선암) 환자 의료 및 단백체 데이터 ● 데이터 상품 부제 암 특화 임상 및 단백체 데이터와 의료데이터 ● 데이터 상품 요약 미국 국립암연구소 (NCI), 가톨릭대학교 의과대학의 폐질환·폐암(선암) 의료 및 단백체 정성·정량 분석 결과 ● 데이터 상품 정보 ■ 상품 설명 및 특징 - 국내 최초·최대 암 관련 (관련 질병 포함) 당 단백질 질량분석 실험 데이터의 해석 및 당·단백질 리포지토리를 구축하고 정밀의료 연구기술에 발전시키고자 함 - 참여 병원으로부터 제공된 폐질환 폐암(선암) 환자 시료를 전처리하여 고분해능 질량분석기기를 통해 최적화된 분석을 진행하고 당사에서 자체 개발한 분석솔루션 SpAC9 Pipeline을 활용하여 데이터분석 등의 프로세스를 통하여 표준화 기준에 맞춰 최종 데이터를 가공, 생산함 - NCI 의 CPTAC에서 제공된 질량분석이 완료된 선암 RAW 데이터는 SpAC9 Pipeline을 활용하여 재분석하고 표준화 기준에 맞춰 데이터를 가공·생산함 ■ 기간 및 범위 - 2022년 9월 ~ 2022년 10월 ■ 컬럼(속성) 정보 - 집계시작년월 : 2022년 9월 - 집계시작년월 : 2022년 10월 ■ 약어/전문용어 설명 - NCI: National Cancer Institute - CPTAC: Clinical Proteome Tumor Analysis Consortium ■ 활용 예제 - 시스템 확대·발전 - 의료 및 단백체 빅데이터 고도화를 위한 유전단백체 변이 아틀라스 구축으로 시스템 확대 및 발전 - 인간의 유전단백체 변이 아틀라스를 구축하여 질병 별로 유전자 변이가 단백질의 변이를 일으키는 경우의 데이터베이스 구축하여 질병의 이해와 개인 맞춤형 신약 개발 및 진단 발굴 사업에 필요한 데이터를 제공

샘플정보
그룹명
결과파일명
결과ID
질량분석기기분석일자
생성일자
수정일자
ID
환자ID
샘플ID
암코드
분석정보
샘플타입
환자나이
환자성별
환자인종
환자민족인종
환자종양위치
환자종양크기
병리학적종양타입명
병리학적종양등급
종양병소
종양측향화
병리학적병기분류
환자국적
종양괴사
병리학적진단
종양분화도
간경변병력
간결절크기
간염병력
B형간염표면항원
B형간염코어항체
프로트롬빈함량
빌리루빈함량
알부민함량
알라닌아미노전이효소함량
감마글루타밀전이효소함량
알파태아단백질함량
아스파르테이트아미노전달효소함량
알칼리인산분해효소함량
TNM병기분류
BCLC병기분류
AJCC병기분류
원발성종양병리학적상태
림프절전이병리학적상태
타장기전이병리학적상태
종양전이범위
암진단이력
치료이력
잔여종양병리학적상태
음주량
흡연이력
흡연나이
금연나이
하루흡연량
연간흡연량
12개월간종양크기
24개월간종양크기
유전자심볼
단백질심볼
단백질명
펩타이드명
펩타이드질량
펩타이드전하
펩타이드스캔1ID
펩타이드스캔2ID
펩타이드값
펩타이드함량
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29638067 C3L-00080 C3L.00080 LUAD 126 Tumor_and_Normal 58 Male White Not-Hispanic or Latino Lower Lobe 4 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IB Other: Unknown Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No CAST NP_001741.4(pre=L,post=K) calpastatin isoform a GN=CAST KGTVPDDAVEALADSLGK 825.1399 3 37567 37580 131.0 2470430000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29638284 C3N-01024 C3N.01024.N LUAD 130N Tumor_and_Normal 66 Female Other 6 Adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIB Vietnam Present Seventh Edition (2010) pT3 pN0 No pathologic evidence of distant metastasis cM0 No WDR1 NP_059830.1(pre=R,post=F) WD repeat-containing protein 1 isoform 1 GN=WDR1 LATGSDDNCAAFFEGPPFK 626.3178 4 37720 37722 122.0 6226270000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29638474 C3L-00080 C3L.00080.N LUAD 127N Tumor_and_Normal 58 Male White Not-Hispanic or Latino Lower Lobe 4 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IB Other: Unknown Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No KRT8 NP_001243211.1(pre=K,post=T) keratin, type II cytoskeletal 8 isoform 1 GN=KRT8 TTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSR 1318.9688 3 37830 37832 232.0 1044020000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29638674 C3N-00547 C3N.00547 LUAD 127C Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No GC NP_001191236.1(pre=K,post=E) vitamin D-binding protein isoform 3 precursor GN=GC SYLSMVGSCCTSASPTVCFLK 938.4636 3 37937 37947 193.0 558925000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29638889 C3N-00547 C3N.00547.N LUAD 128N Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No TRIM21 NP_003132.2(pre=A,post=C) E3 ubiquitin-protein ligase TRIM21 GN=TRIM21 QQSQALQELISELDRR 715.06 3 38034 38044 103.0 911343000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29639276 C3L-00080 C3L.00080 LUAD 126 Tumor_and_Normal 58 Male White Not-Hispanic or Latino Lower Lobe 4 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IB Other: Unknown Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No LAMTOR2 NP_054736.1(pre=R,post=N) ragulator complex protein LAMTOR2 isoform 1 GN=LAMTOR2 VTAAIASNIWAAYDR 926.0038 2 38251 38254 155.0 1333570000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29639344 C3N-01023 C3N.01023 LUAD 128C Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No KCNIP1 NP_001265268.1(pre=K,post=Y) Kv channel-interacting protein 1 isoform 5 GN=KCNIP1 EEMMDIVKAIYDMMGK 652.6004 4 38283 38291 39.0 230748000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29639807 C3N-01023 C3N.01023.N LUAD 129N Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No METTL13 NP_057019.3(pre=K,post=D) methyltransferase-like protein 13 isoform 1 GN=METTL13 VLVIGCGNSELSEQLYDVGYR 867.4455 3 38518 38527 176.0 1401990000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29640150 C3N-01024 C3N.01024 LUAD 129C Tumor_and_Normal 66 Female Other 6 Adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIB Vietnam Present Seventh Edition (2010) pT3 pN0 No pathologic evidence of distant metastasis cM0 No TUBA1C NP_001290043.1(pre=R,post=T) tubulin alpha-1C chain isoform a GN=TUBA1C AVFVDLEPTVIDEVR 644.3649 3 38835 38838 99.0 631269000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29640503 C3N-00579 C3N.00579 LUAD 128C Tumor_and_Normal 67 Male Other 4 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Right Stage IB Vietnam Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No F13A1 NP_000120.2(pre=F,post=K) coagulation factor XIII A chain precursor GN=F13A1 AEVNSDLIYITAK 948.0545 2 30389 30393 68.0 70605700.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29640541 C3N-00199 C3N.00199 LUAD 127C Tumor_and_Normal 65 Male White Not-Hispanic or Latino Upper Lobe 3 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IA United States Not identified Seventh Edition (2010) pT1b pN0 Staging Incomplete Staging Incomplete No DDX5 NP_001307524.1(pre=K,post=Q) probable ATP-dependent RNA helicase DDX5 isoform a GN=DDX5 TGTAYTFFTPNNIK 678.3765 3 30389 30405 85.0 2739150000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29640666 C3N-00199 C3N.00199.N LUAD 128N Tumor_and_Normal 65 Male White Not-Hispanic or Latino Upper Lobe 3 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IA United States Not identified Seventh Edition (2010) pT1b pN0 Staging Incomplete Staging Incomplete No PAXX NP_001316607.1(pre=R,post=G) protein PAXX isoform 1 GN=PAXX PAGPQLFLPDPDPQR 939.0065 2 30486 30494 78.0 129906000.0
04CPTAC_LUAD_Proteome_BI_20180524 04CPTAC_LUAD_W_BI_20180524_KR_f17.raw CPTAC_Proteome 20180524 20221101 1147981 C3N-02588 C3N.02588 LUAD 127C Tumor_and_Normal 69 Male Lower Lobe 5 Adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIA China Not identified Seventh Edition (2010) pT2a pN0 pM1b cM0 No CCZ1 NP_056437.4(pre=R,post=N) vacuolar fusion protein CCZ1 homolog GN=CCZ1 ELYVILNQK 789.4839 2 31274 31283 158.0 244730000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29641730 C3N-00547 C3N.00547 LUAD 127C Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No PCYOX1 NP_057381.3(pre=K,post=Q) prenylcysteine oxidase 1 precursor GN=PCYOX1 IAIIGAGIGGTSAAYYLR 666.0549 3 39384 39385 118.0 1301530000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29641892 C3N-02582 C3N.02582 LUAD 129C Tumor_and_Normal 77 Male Upper Lobe 6 Adenocarcinoma G3 Poorly differentiated Unifocal Left Stage IIA China Not identified Seventh Edition (2010) pT2b pN1 Staging Incomplete cM0 No PNP NP_000261.2(pre=R,post=V) purine nucleoside phosphorylase GN=PNP FHMYEGYPLWK 483.0109 4 31080 31082 16.0 113247000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29642015 C3N-02379 C3N.02379.1 LUAD 130C Tumor_and_Normal 57 Female Upper Lobe 4 Adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIB China Not identified Seventh Edition (2010) pT2a pN1 Staging Incomplete cM0 No LTN1 NP_056380.2(pre=K,post=E) E3 ubiquitin-protein ligase listerin isoform 1 GN=LTN1 DEITSVLQDHLIK 657.0491 3 31119 31123 175.0 163042000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29642192 C3N-00199 C3N.00199 LUAD 127C Tumor_and_Normal 65 Male White Not-Hispanic or Latino Upper Lobe 3 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IA United States Not identified Seventh Edition (2010) pT1b pN0 Staging Incomplete Staging Incomplete No ATP6V1C1 NP_001686.1(pre=K,post=S) V-type proton ATPase subunit C 1 GN=ATP6V1C1 QYETLAEMVVPR 555.6351 3 31256 31260 114.0 132391000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29642709 C3N-02582 C3N.02582.N LUAD 130N Tumor_and_Normal 77 Male Upper Lobe 6 Adenocarcinoma G3 Poorly differentiated Unifocal Left Stage IIA China Not identified Seventh Edition (2010) pT2b pN1 Staging Incomplete cM0 No CKB NP_001349460.1(pre=K,post=A) creatine kinase B-type isoform 2 GN=CKB VLTPELYAELR 511.6363 3 31774 31779 53.0 707951000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29644344 C3L-00604 C3L.00604 LUAD 126 Tumor_and_Normal 61 Female White Not-Hispanic or Latino Upper Lobe 3 Acinar adenocarcinoma G2 Moderately differentiated Multifocal Right Stage IIIA United States Not identified Seventh Edition (2010) pT3 pN2 No pathologic evidence of distant metastasis cM0 No LAMA2 NP_000417.2(pre=K,post=L) laminin subunit alpha-2 isoform a precursor GN=LAMA2 CDCPLGYSGLSCEACLPGFYR 904.4081 3 32504 32510 68.0 37502200.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29644587 C3L-00604 C3L.00604 LUAD 126 Tumor_and_Normal 61 Female White Not-Hispanic or Latino Upper Lobe 3 Acinar adenocarcinoma G2 Moderately differentiated Multifocal Right Stage IIIA United States Not identified Seventh Edition (2010) pT3 pN2 No pathologic evidence of distant metastasis cM0 No PRELP NP_002716.1(pre=P,post=N) prolargin precursor GN=PRELP GLVFLYMEK 525.3069 3 32626 32632 33.0 235112000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29644848 C3L-00604 C3L.00604 LUAD 126 Tumor_and_Normal 61 Female White Not-Hispanic or Latino Upper Lobe 3 Acinar adenocarcinoma G2 Moderately differentiated Multifocal Right Stage IIIA United States Not identified Seventh Edition (2010) pT3 pN2 No pathologic evidence of distant metastasis cM0 No PPM1F NP_055449.1(pre=R,post=Q) protein phosphatase 1F GN=PPM1F LWEVAGQWQK 568.3281 3 32766 32770 54.0 692834000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29645112 C3N-02582 C3N.02582 LUAD 129C Tumor_and_Normal 77 Male Upper Lobe 6 Adenocarcinoma G3 Poorly differentiated Unifocal Left Stage IIA China Not identified Seventh Edition (2010) pT2b pN1 Staging Incomplete cM0 No TACC2 NP_996744.3(pre=R,post=S) transforming acidic coiled-coil-containing protein 2 isoform a GN=TACC2 MESFLTLESEK 886.4875 2 32903 32904 103.0 37318700.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29645717 C3N-00199 C3N.00199.N LUAD 128N Tumor_and_Normal 65 Male White Not-Hispanic or Latino Upper Lobe 3 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IA United States Not identified Seventh Edition (2010) pT1b pN0 Staging Incomplete Staging Incomplete No MARF1 NP_001171927.1(pre=K,post=S) meiosis regulator and mRNA stability factor 1 isoform 2 GN=MARF1 ILVSLATGAASK 530.3411 3 33150 33156 41.0 12789600.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29646905 C3L-00604 C3L.00604 LUAD 126 Tumor_and_Normal 61 Female White Not-Hispanic or Latino Upper Lobe 3 Acinar adenocarcinoma G2 Moderately differentiated Multifocal Right Stage IIIA United States Not identified Seventh Edition (2010) pT3 pN2 No pathologic evidence of distant metastasis cM0 No TCP1 NP_110379.2(pre=R,post=T) T-complex protein 1 subunit alpha isoform a GN=TCP1 YINENLIVNTDELGRDCLINAAK 777.4231 4 33742 33745 153.0 442271000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29646906 C3N-02379 C3N.02379.1 LUAD 130C Tumor_and_Normal 57 Female Upper Lobe 4 Adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIB China Not identified Seventh Edition (2010) pT2a pN1 Staging Incomplete cM0 No TCP1 NP_110379.2(pre=R,post=T) T-complex protein 1 subunit alpha isoform a GN=TCP1 YINENLIVNTDELGRDCLINAAK 777.4231 4 33742 33745 153.0 442271000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29646925 C3N-02582 C3N.02582.N LUAD 130N Tumor_and_Normal 77 Male Upper Lobe 6 Adenocarcinoma G3 Poorly differentiated Unifocal Left Stage IIA China Not identified Seventh Edition (2010) pT2b pN1 Staging Incomplete cM0 No PRPF4 NP_004688.2(pre=K,post=G) U4/U6 small nuclear ribonucleoprotein Prp4 isoform 1 GN=PRPF4 LWSVPDCNLLHTLR 651.6915 3 33748 33755 67.0 174270000.0
10CPTAC_LUAD_Proteome_BI_20180626 10CPTAC_LUAD_W_BI_20180626_KR_f19.raw CPTAC_Proteome 20180524 20221101 20243706 11LU022 X11LU022 LUAD 130C Tumor 53 Male Other 4 Other GX Grade cannot be assessed Unifocal Left Stage IB Vietnam Present Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No DPYSL3 NP_001184223.1(pre=R,post=I) dihydropyrimidinase-related protein 3 isoform 1 GN=DPYSL3 ISVGSDSDLVIWDPDAVK 1187.6492 2 38761 38766 92.0 51784600.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29647076 C3L-00604 C3L.00604 LUAD 126 Tumor_and_Normal 61 Female White Not-Hispanic or Latino Upper Lobe 3 Acinar adenocarcinoma G2 Moderately differentiated Multifocal Right Stage IIIA United States Not identified Seventh Edition (2010) pT3 pN2 No pathologic evidence of distant metastasis cM0 No LARP1 NP_056130.2(pre=K,post=E) la-related protein 1 GN=LARP1 WVPLQIDMKPEVPR 542.3197 4 33831 33832 60.0 29316800.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29647215 C3N-00579 C3N.00579.N LUAD 129N Tumor_and_Normal 67 Male Other 4 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Right Stage IB Vietnam Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No TARS NP_001245367.1(pre=R,post=W) threonine--tRNA ligase, cytoplasmic isoform 2 GN=TARS MIAILTENYGGK 590.0085 3 33900 33903 91.0 1444780000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29647308 C3N-00199 C3N.00199 LUAD 127C Tumor_and_Normal 65 Male White Not-Hispanic or Latino Upper Lobe 3 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IA United States Not identified Seventh Edition (2010) pT1b pN0 Staging Incomplete Staging Incomplete No BCCIP NP_057651.1(pre=K,post=F) BRCA2 and CDKN1A-interacting protein isoform BCCIPalpha GN=BCCIP FLNDTTKPVGLLLSER 754.4473 3 33952 33962 213.0 624834000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29647322 C3N-02582 C3N.02582 LUAD 129C Tumor_and_Normal 77 Male Upper Lobe 6 Adenocarcinoma G3 Poorly differentiated Unifocal Left Stage IIA China Not identified Seventh Edition (2010) pT2b pN1 Staging Incomplete cM0 No UBA1 NP_003325.2(pre=R,post=R) ubiquitin-like modifier-activating enzyme 1 GN=UBA1 QLLHNFPPDQLTSSGAPFWSGPK 994.8661 3 33952 33964 153.0 2117860000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29647555 C3N-02582 C3N.02582 LUAD 129C Tumor_and_Normal 77 Male Upper Lobe 6 Adenocarcinoma G3 Poorly differentiated Unifocal Left Stage IIA China Not identified Seventh Edition (2010) pT2b pN1 Staging Incomplete cM0 No PSMC5 NP_002796.4(pre=R,post=I) 26S proteasome regulatory subunit 8 isoform 1 GN=PSMC5 IDILDSALLRPGR 556.6737 3 34051 34056 110.0 5254460000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29648176 C3N-00547 C3N.00547 LUAD 127C Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No PRKDC NP_008835.5(pre=K,post=A) DNA-dependent protein kinase catalytic subunit isoform 1 GN=PRKDC ETGLMYSIMVHALR 617.3376 3 39038 39047 90.0 19239000000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29649463 C3N-00547 C3N.00547.N LUAD 128N Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No MAPK8IP3 NP_001305781.1(pre=K,post=N) C-Jun-amino-terminal kinase-interacting protein 3 isoform 3 GN=MAPK8IP3 EVGNLLLENSQLLETK 753.4314 3 39790 39796 101.0 93707700.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29649474 C3L-00080 C3L.00080 LUAD 126 Tumor_and_Normal 58 Male White Not-Hispanic or Latino Lower Lobe 4 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IB Other: Unknown Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No SYAP1 NP_116185.2(pre=K,post=N) synapse-associated protein 1 GN=SYAP1 KSEAAVPPWVDTNDEETIQQQILALSADKR 808.8445 5 39800 39801 160.0 603754000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29649615 C3N-00547 C3N.00547.N LUAD 128N Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No ALDOA NP_001230106.1(pre=K,post=A) fructose-bisphosphate aldolase A isoform 2 GN=ALDOA CPLLKPWALTFSYGR 756.4354 3 39904 39910 129.0 6955480000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29649967 C3N-00547 C3N.00547.N LUAD 128N Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No DNPEP NP_001306045.1(pre=Y,post=V) aspartyl aminopeptidase isoform a GN=DNPEP GGGIWSTWFDRDLTLAGR 746.3928 3 40146 40148 67.0 24665300.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29649997 C3N-01023 C3N.01023.N LUAD 129N Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No TRAF2 NP_066961.2(pre=K,post=-) TNF receptor-associated factor 2 GN=TRAF2 AIVDLTGL 515.8222 2 40169 40170 90.0 236968000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29650237 C3N-01023 C3N.01023.N LUAD 129N Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No SERPINB6 NP_001258752.1(pre=R,post=S) serpin B6 isoform d GN=SERPINB6 FCADHPFLFFIQH 636.6541 3 40287 40290 137.0 3338090000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29650588 C3N-01024 C3N.01024 LUAD 129C Tumor_and_Normal 66 Female Other 6 Adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIB Vietnam Present Seventh Edition (2010) pT3 pN0 No pathologic evidence of distant metastasis cM0 No MRPS22 NP_064576.1(pre=P,post=M) 28S ribosomal protein S22, mitochondrial isoform 1 GN=MRPS22 TFMDEEVQSILTK 667.0336 3 40511 40514 108.0 1055390000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29651715 C3N-01024 C3N.01024.N LUAD 130N Tumor_and_Normal 66 Female Other 6 Adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIB Vietnam Present Seventh Edition (2010) pT3 pN0 No pathologic evidence of distant metastasis cM0 No FAM122A NP_612206.4(pre=K,post=-) protein FAM122A GN=FAM122A VSTTTDSPVSPAQAASPFIPLDELSSK 1068.5789 3 41164 41175 171.0 362819000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29651733 C3N-01023 C3N.01023.N LUAD 129N Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No ASAH1 NP_004306.3(pre=K,post=G) acid ceramidase isoform b GN=ASAH1 LTVYTTLIDVTK 609.0416 3 41187 41189 116.0 39956900000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29651864 C3N-00547 C3N.00547 LUAD 127C Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No MYLK NP_444253.3(pre=K,post=D) myosin light chain kinase, smooth muscle isoform 1 GN=MYLK IEGYPDPEVVWFK 679.7085 3 41263 41272 125.0 8413130000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29652405 C3N-01023 C3N.01023.N LUAD 129N Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No NP_919337.1(pre=K,post=E) FVEAMAEYNEAQTLFR 716.6949 3 41537 41547 144.0 157822000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29652639 C3N-00547 C3N.00547.N LUAD 128N Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No TUBB6 NP_001290453.1(pre=K,post=R) tubulin beta-6 chain isoform 1 GN=TUBB6 MASTFIGNSTAIQELFK 778.0926 3 41677 41678 89.0 10823500000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29652985 C3L-00080 C3L.00080.N LUAD 127N Tumor_and_Normal 58 Male White Not-Hispanic or Latino Lower Lobe 4 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IB Other: Unknown Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No MIA2 NP_001316143.1(pre=R,post=L) cTAGE family member 5 isoform 8 precursor GN=MIA2 AFLSPPTLLEGPLR 580.6817 3 41918 41924 67.0 605415000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29653062 C3N-01023 C3N.01023 LUAD 128C Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No SERPINA1 NP_000286.3(pre=K,post=E) alpha-1-antitrypsin precursor GN=SERPINA1 AVLTIDEKGTEAAGAMFL 765.7625 3 41966 41970 194.0 353030000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29653400 C3N-00547 C3N.00547 LUAD 127C Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No TOP1 NP_003277.1(pre=K,post=E) DNA topoisomerase 1 GN=TOP1 HKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHK 1198.69 6 42192 42209 -101.0 63097000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29653574 C3N-01023 C3N.01023 LUAD 128C Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No KDM1A NP_001009999.1(pre=R,post=Q) lysine-specific histone demethylase 1A isoform a GN=KDM1A IADQFLGAMYTLPR 609.0029 3 42311 42315 112.0 931314000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29653774 C3N-01023 C3N.01023 LUAD 128C Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No TBCC NP_003183.1(pre=R,post=D) tubulin-specific chaperone C GN=TBCC AIVEDCSGIQFAPYTWSYPEIDK 787.6522 4 42374 42386 156.0 169960000.0
10CPTAC_LUAD_Proteome_BI_20180626 10CPTAC_LUAD_W_BI_20180626_KR_f19.raw CPTAC_Proteome 20180524 20221101 20243735 C3L-00913 C3L.00913 LUAD 129C Tumor_and_Normal 66 Male White Not-Hispanic or Latino Other 8 Adenocarcinoma G2 Moderately differentiated Unifocal Right Stage IIIA United States Present Seventh Edition (2010) pT3 pN1 No pathologic evidence of distant metastasis cM1 No APOA1 NP_000030.1(pre=R,post=E) apolipoprotein A-I isoform 1 preproprotein GN=APOA1 EQLGPVTQEFWDNLEK 1196.1316 2 38796 38797 261.0 1320820.0
10CPTAC_LUAD_Proteome_BI_20180626 10CPTAC_LUAD_W_BI_20180626_KR_f19.raw CPTAC_Proteome 20180524 20221101 20243736 C3L-00510 C3L.00510.N LUAD 129N Tumor_and_Normal 80 Female Unknown Not reported Lower Lobe 3 Adenocarcinoma G1 Well differentiated Unifocal Right Stage IA United States Not identified Seventh Edition (2010) pT1b pN0 Staging Incomplete Staging Incomplete No APOA1 NP_000030.1(pre=R,post=E) apolipoprotein A-I isoform 1 preproprotein GN=APOA1 EQLGPVTQEFWDNLEK 1196.1316 2 38796 38797 261.0 1320820.0
10CPTAC_LUAD_Proteome_BI_20180626 10CPTAC_LUAD_W_BI_20180626_KR_f19.raw CPTAC_Proteome 20180524 20221101 20243737 C3L-00510 C3L.00510 LUAD 128C Tumor_and_Normal 80 Female Unknown Not reported Lower Lobe 3 Adenocarcinoma G1 Well differentiated Unifocal Right Stage IA United States Not identified Seventh Edition (2010) pT1b pN0 Staging Incomplete Staging Incomplete No APOA1 NP_000030.1(pre=R,post=E) apolipoprotein A-I isoform 1 preproprotein GN=APOA1 EQLGPVTQEFWDNLEK 1196.1316 2 38796 38797 261.0 1320820.0
10CPTAC_LUAD_Proteome_BI_20180626 10CPTAC_LUAD_W_BI_20180626_KR_f19.raw CPTAC_Proteome 20180524 20221101 20243738 C3L-00093 C3L.00093.N LUAD 128N Tumor_and_Normal 66 Female White Not-Hispanic or Latino Lower Lobe 3 Other G2 Moderately differentiated Unifocal Left Stage IB United States Not identified Seventh Edition (2010) pT2a pN0 No pathologic evidence of distant metastasis cM0 Yes APOA1 NP_000030.1(pre=R,post=E) apolipoprotein A-I isoform 1 preproprotein GN=APOA1 EQLGPVTQEFWDNLEK 1196.1316 2 38796 38797 261.0 1320820.0
10CPTAC_LUAD_Proteome_BI_20180626 10CPTAC_LUAD_W_BI_20180626_KR_f19.raw CPTAC_Proteome 20180524 20221101 20243739 C3L-00093 C3L.00093 LUAD 127C Tumor_and_Normal 66 Female White Not-Hispanic or Latino Lower Lobe 3 Other G2 Moderately differentiated Unifocal Left Stage IB United States Not identified Seventh Edition (2010) pT2a pN0 No pathologic evidence of distant metastasis cM0 Yes APOA1 NP_000030.1(pre=R,post=E) apolipoprotein A-I isoform 1 preproprotein GN=APOA1 EQLGPVTQEFWDNLEK 1196.1316 2 38796 38797 261.0 1320820.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29653798 C3N-01023 C3N.01023 LUAD 128C Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No FLNA NP_001104026.1(pre=R,post=P) filamin-A isoform 2 GN=FLNA ALGALVDSCAPGLCPDWDSWDASK 610.7016 5 42395 42399 89.0 735778000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29653862 C3N-01023 C3N.01023 LUAD 128C Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No POLR2B NP_000929.1(pre=R,post=F) DNA-directed RNA polymerase II subunit RPB2 isoform 1 GN=POLR2B TSETGIVDQVMVTLNQEGYK 890.8079 3 42395 42412 173.0 1232330000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29654554 C3L-00080 C3L.00080 LUAD 126 Tumor_and_Normal 58 Male White Not-Hispanic or Latino Lower Lobe 4 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IB Other: Unknown Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No MARS NP_004981.2(pre=R,post=F) methionine--tRNA ligase, cytoplasmic GN=MARS GVGVFGDMAQDTGIPADIWR 1167.5912 2 42828 42845 236.0 117193000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29654629 C3N-01023 C3N.01023.N LUAD 129N Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No SDCBP NP_001335270.1(pre=R,post=A) syntenin-1 isoform 7 GN=SDCBP LYPELSQYMGLSLNEEEIR 838.4338 3 42914 42915 145.0 3958520000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29655194 C3L-00080 C3L.00080.N LUAD 127N Tumor_and_Normal 58 Male White Not-Hispanic or Latino Lower Lobe 4 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IB Other: Unknown Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No SQOR NP_001258142.1(pre=K,post=T) sulfide:quinone oxidoreductase, mitochondrial GN=SQOR QEAVFENLDKPGETQVISYEMLHVTPPMSPPDVLK 1157.3698 4 43207 43225 255.0 1067250000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29655405 C3N-01024 C3N.01024.N LUAD 130N Tumor_and_Normal 66 Female Other 6 Adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIB Vietnam Present Seventh Edition (2010) pT3 pN0 No pathologic evidence of distant metastasis cM0 No NNT NP_036475.3(pre=K,post=L) NAD(P) transhydrogenase, mitochondrial isoform 1 GN=NNT TSGTLISFIYPAQNPELLNK 1332.7559 2 43327 43329 153.0 0.0
13CPTAC_LUAD_Proteome_BI_20180629 13CPTAC_LUAD_W_BI_20180629_KR_f22.raw CPTAC_Proteome 20180524 20221101 29655624 C3L-00001 C3L.00001 LUAD 129C Tumor_and_Normal 61 Female White Not-Hispanic or Latino Upper Lobe 4 Adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIA United States Not identified Seventh Edition (2010) pT2a pN1 Staging Incomplete cM0 No EP400 NP_056224.3(pre=K,post=N) E1A-binding protein p400 GN=EP400 PLLGMNPFQK 801.9763 2 37312 37314 54.0 17982000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29656624 C3N-00199 C3N.00199.N LUAD 128N Tumor_and_Normal 65 Male White Not-Hispanic or Latino Upper Lobe 3 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IA United States Not identified Seventh Edition (2010) pT1b pN0 Staging Incomplete Staging Incomplete No MIF NP_002406.1(pre=K,post=L) macrophage migration inhibitory factor GN=MIF LLCGLLAER 637.379 2 34632 34634 44.0 61965200.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29656635 C3L-00604 C3L.00604.N LUAD 127N Tumor_and_Normal 61 Female White Not-Hispanic or Latino Upper Lobe 3 Acinar adenocarcinoma G2 Moderately differentiated Multifocal Right Stage IIIA United States Not identified Seventh Edition (2010) pT3 pN2 No pathologic evidence of distant metastasis cM0 No TUBA4A NP_005991.1(pre=K,post=H) tubulin alpha-4A chain isoform 1 GN=TUBA4A TIGGGDDSFTTFFCETGAGK 842.7481 3 34632 34637 110.0 6637510000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29656712 C3N-00579 C3N.00579 LUAD 128C Tumor_and_Normal 67 Male Other 4 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Right Stage IB Vietnam Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No DNAJA2 NP_005871.1(pre=K,post=R) dnaJ homolog subfamily A member 2 GN=DNAJA2 EISFAYEVLSNPEK 521.7895 4 34664 34667 71.0 47079000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29657757 C3N-01023 C3N.01023 LUAD 128C Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No FASN NP_004095.4(pre=R,post=L) fatty acid synthase GN=FASN LQLNGNLQLELAQVLAQERPK 709.1709 4 43475 43482 144.0 829831000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29658331 C3N-01024 C3N.01024 LUAD 129C Tumor_and_Normal 66 Female Other 6 Adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIB Vietnam Present Seventh Edition (2010) pT3 pN0 No pathologic evidence of distant metastasis cM0 No NQO1 NP_000894.1(pre=K,post=A) NAD(P)H dehydrogenase [quinone] 1 isoform a GN=NQO1 RLENIWDETPLYF 963.0028 2 43741 43746 52.0 228093000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29658439 C3N-00547 C3N.00547 LUAD 127C Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No STX5 NP_003155.2(pre=K,post=Q) syntaxin-5 isoform 1 GN=STX5 AVEIEELTYIIK 627.0478 3 43804 43809 125.0 1825390000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29658980 C3N-01023 C3N.01023.N LUAD 129N Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No STARD10 NP_006636.2(pre=R,post=H) START domain-containing protein 10 GN=STARD10 SWLPMGADYIIMNYSVK 821.4373 3 44044 44056 119.0 48106600.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29659312 C3L-00080 C3L.00080.N LUAD 127N Tumor_and_Normal 58 Male White Not-Hispanic or Latino Lower Lobe 4 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IB Other: Unknown Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No CMPK1 NP_057392.1(pre=K,post=G) UMP-CMP kinase isoform a GN=CMPK1 PLVVFVLGGPGAGK 885.0631 2 44191 44192 147.0 1581340000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29659313 C3L-00080 C3L.00080 LUAD 126 Tumor_and_Normal 58 Male White Not-Hispanic or Latino Lower Lobe 4 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IB Other: Unknown Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No CMPK1 NP_057392.1(pre=K,post=G) UMP-CMP kinase isoform a GN=CMPK1 PLVVFVLGGPGAGK 885.0631 2 44191 44192 147.0 1581340000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29659554 C3N-01023 C3N.01023.N LUAD 129N Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No PLD3 NP_001026866.1(pre=R,post=D) phospholipase D3 GN=PLD3 AFLLSLAALR 435.2805 3 44254 44260 114.0 107544000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29659688 C3N-01024 C3N.01024.N LUAD 130N Tumor_and_Normal 66 Female Other 6 Adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIB Vietnam Present Seventh Edition (2010) pT3 pN0 No pathologic evidence of distant metastasis cM0 No BAG2 NP_004273.1(pre=K,post=Q) BAG family molecular chaperone regulator 2 GN=BAG2 EILLEMIHSIQNSQDMR 762.7295 3 44317 44320 208.0 568809000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29660079 C3L-00080 C3L.00080 LUAD 126 Tumor_and_Normal 58 Male White Not-Hispanic or Latino Lower Lobe 4 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IB Other: Unknown Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No HSPG2 NP_001278789.1(pre=K,post=A) basement membrane-specific heparan sulfate proteoglycan core protein isoform a precursor GN=HSPG2 FQGLDLNEELYLGGYPDYGAIPK 758.4034 4 44731 44734 98.0 2391870000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29661206 C3L-00080 C3L.00080.N LUAD 127N Tumor_and_Normal 58 Male White Not-Hispanic or Latino Lower Lobe 4 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IB Other: Unknown Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No UGDH NP_003350.1(pre=K,post=K) UDP-glucose 6-dehydrogenase isoform 1 GN=UGDH IAILGFAFK 479.9802 3 45842 45854 120.0 512024000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29661293 C3N-00547 C3N.00547 LUAD 127C Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No EEF1G NP_001395.1(pre=P,post=L) elongation factor 1-gamma GN=EEF1G EELTQTFMSCNLITGMFQR 851.0906 3 45939 45948 90.0 215604000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29661456 C3N-01024 C3N.01024.N LUAD 130N Tumor_and_Normal 66 Female Other 6 Adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIB Vietnam Present Seventh Edition (2010) pT3 pN0 No pathologic evidence of distant metastasis cM0 No EPPK1 NP_112598.3(pre=R,post=R) epiplakin GN=EPPK1 EELLAEFGSGTLDLPALTR 754.4124 3 46127 46131 108.0 9266880000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29661604 C3N-00547 C3N.00547.N LUAD 128N Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No CST3 NP_000090.1(pre=K,post=S) cystatin-C precursor GN=CST3 AFCSFQIYAVPWQGTMTLSK 931.8258 3 46227 46238 135.0 16062900.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29661718 C3L-00080 C3L.00080.N LUAD 127N Tumor_and_Normal 58 Male White Not-Hispanic or Latino Lower Lobe 4 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IB Other: Unknown Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No KMT2B NP_055542.1(pre=R,post=N) histone-lysine N-methyltransferase 2B GN=KMT2B ARPPEDLPSEIVDFVLK 795.1297 3 46291 46295 109.0 6913720000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29662284 C3N-01023 C3N.01023 LUAD 128C Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No HBB NP_000509.1(pre=R,post=V) hemoglobin subunit beta GN=HBB LLGNVLVCVLAHHFGKEFTPPVQAAYQK 956.7976 4 46522 46533 234.0 42254900.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29662853 C3N-01023 C3N.01023 LUAD 128C Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No HPX NP_000604.1(pre=K,post=G) hemopexin precursor GN=HPX LYLVQGTQVYVFLTK 1115.669 2 46732 46740 280.0 122229000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29663277 C3N-01023 C3N.01023 LUAD 128C Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No HBB NP_000509.1(pre=R,post=H) hemoglobin subunit beta GN=HBB LLGNVLVCVLAH 512.9751 3 46858 46867 74.0 44032200.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29663740 C3N-01023 C3N.01023.N LUAD 129N Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No PACS1 NP_060496.2(pre=K,post=I) phosphofurin acidic cluster sorting protein 1 GN=PACS1 VVYDQLNQILVSDAALPENV 810.4441 3 47005 47013 93.0 366502000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29663797 C3N-01023 C3N.01023 LUAD 128C Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No GALK1 NP_000145.1(pre=R,post=M) galactokinase GN=GALK1 SLRDDYEVSCPELDQLVEAALAVPGVYGSR 885.1976 4 47026 47029 241.0 244079000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29664013 C3N-01023 C3N.01023 LUAD 128C Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No NP_001265476.1(pre=K,post=S) NIIGLLNVFTPQK 639.0668 3 47068 47082 119.0 166399000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29664406 C3N-00547 C3N.00547.N LUAD 128N Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No PLS1 NP_001138791.1(pre=K,post=P) plastin-1 GN=PLS1 LNLAFVANLFNTYPCLHK 649.1166 4 47173 47188 95.0 109299000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29664742 C3N-00547 C3N.00547.N LUAD 128N Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No KTN1 NP_001072989.1(pre=K,post=E) kinectin isoform a GN=KTN1 TMMFSEDEALCVVDLLK 1230.138 2 47278 47294 254.0 15275400.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29664879 C3N-00547 C3N.00547 LUAD 127C Tumor_and_Normal 60 Male Other 5 Acinar adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IIA Vietnam Not identified Seventh Edition (2010) pT2b pN0 Staging Incomplete cM0 No PPP1R10 NP_002705.2(pre=K,post=G) serine/threonine-protein phosphatase 1 regulatory subunit 10 GN=PPP1R10 LPPVLANLMGSMGAGK 672.0571 3 47320 47335 136.0 97302500.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29665301 C3N-01023 C3N.01023 LUAD 128C Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No ARFGEF1 NP_006412.2(pre=K,post=M) brefeldin A-inhibited guanine nucleotide-exchange protein 1 GN=ARFGEF1 ATLTQMLNVIFAR 853.9971 2 47467 47476 153.0 154535000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29665424 C3L-00080 C3L.00080.N LUAD 127N Tumor_and_Normal 58 Male White Not-Hispanic or Latino Lower Lobe 4 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IB Other: Unknown Not identified Seventh Edition (2010) pT2a pN0 Staging Incomplete cM0 No GNPNAT1 NP_932332.1(pre=K,post=K) glucosamine 6-phosphate N-acetyltransferase GN=GNPNAT1 LLLSTLTLLSK 554.0413 3 47488 47507 121.0 164718000.0
21CPTAC_LUAD_Proteome_BI_20180817 21CPTAC_LUAD_W_BI_20180817_KR_f24.raw CPTAC_Proteome 20180524 20221101 29665468 C3N-01023 C3N.01023.N LUAD 129N Tumor_and_Normal 58 Male Other 6 Solid adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIIA Vietnam Present Seventh Edition (2010) pT2a pN2 Staging Incomplete cM0 No LCP1 NP_002289.2(pre=K,post=Y) plastin-2 GN=LCP1 LNLAFIANLFNR 817.9856 2 47509 47516 188.0 7059290000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29665836 C3N-00199 C3N.00199 LUAD 127C Tumor_and_Normal 65 Male White Not-Hispanic or Latino Upper Lobe 3 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IA United States Not identified Seventh Edition (2010) pT1b pN0 Staging Incomplete Staging Incomplete No HPS6 NP_079023.2(pre=K,post=E) Hermansky-Pudlak syndrome 6 protein GN=HPS6 AVLQAVGQLVQK 856.5482 2 35179 35185 152.0 13933000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29666420 C3N-00199 C3N.00199.N LUAD 128N Tumor_and_Normal 65 Male White Not-Hispanic or Latino Upper Lobe 3 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IA United States Not identified Seventh Edition (2010) pT1b pN0 Staging Incomplete Staging Incomplete No CALR NP_004334.1(pre=K,post=I) calreticulin precursor GN=CALR DDEFTHLYTLIVRPDNTYEVK 1009.5357 3 35447 35449 146.0 845596000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29666551 C3N-02582 C3N.02582.N LUAD 130N Tumor_and_Normal 77 Male Upper Lobe 6 Adenocarcinoma G3 Poorly differentiated Unifocal Left Stage IIA China Not identified Seventh Edition (2010) pT2b pN1 Staging Incomplete cM0 No EFTUD2 NP_001245282.1(pre=K,post=R) 116 kDa U5 small nuclear ribonucleoprotein component isoform a GN=EFTUD2 IYADTFGDINYQEFAK 1177.1108 2 35480 35493 92.0 22512200.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29666690 C3N-00199 C3N.00199.N LUAD 128N Tumor_and_Normal 65 Male White Not-Hispanic or Latino Upper Lobe 3 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IA United States Not identified Seventh Edition (2010) pT1b pN0 Staging Incomplete Staging Incomplete No DDB1 NP_001914.3(pre=K,post=H) DNA damage-binding protein 1 GN=DDB1 FLYGCQAPTICFVYQDPQGR 883.7655 3 35520 35528 109.0 2113700000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29666783 C3L-00604 C3L.00604 LUAD 126 Tumor_and_Normal 61 Female White Not-Hispanic or Latino Upper Lobe 3 Acinar adenocarcinoma G2 Moderately differentiated Multifocal Right Stage IIIA United States Not identified Seventh Edition (2010) pT3 pN2 No pathologic evidence of distant metastasis cM0 No C1QBP NP_001203.1(pre=K,post=V) complement component 1 Q subcomponent-binding protein, mitochondrial precursor GN=C1QBP ITVTFNINNSIPPTFDGEEEPSQGQK 1107.5748 3 35580 35587 133.0 380693000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29666802 C3N-02379 C3N.02379.1 LUAD 130C Tumor_and_Normal 57 Female Upper Lobe 4 Adenocarcinoma G3 Poorly differentiated Unifocal Right Stage IIB China Not identified Seventh Edition (2010) pT2a pN1 Staging Incomplete cM0 No UHRF1 NP_037414.3(pre=K,post=E) E3 ubiquitin-protein ligase UHRF1 isoform 2 GN=UHRF1 KLGLTMQYPEGYLEALANR 875.8185 3 35589 35600 44.0 38293400.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29667041 C3N-00199 C3N.00199.N LUAD 128N Tumor_and_Normal 65 Male White Not-Hispanic or Latino Upper Lobe 3 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IA United States Not identified Seventh Edition (2010) pT1b pN0 Staging Incomplete Staging Incomplete No AGRN NP_001292204.1(pre=R,post=S) agrin isoform 1 precursor GN=AGRN AAAVSSGFDGAIQLV 817.9539 2 35713 35716 134.0 164576000.0
23CPTAC_LUAD_Proteome_BI_20180822 23CPTAC_LUAD_W_BI_20180822_KR_f23.raw CPTAC_Proteome 20180524 20221101 29667446 C3N-00199 C3N.00199 LUAD 127C Tumor_and_Normal 65 Male White Not-Hispanic or Latino Upper Lobe 3 Adenocarcinoma G2 Moderately differentiated Unifocal Left Stage IA United States Not identified Seventh Edition (2010) pT1b pN0 Staging Incomplete Staging Incomplete No ELANE NP_001963.1(pre=F,post=S) neutrophil elastase preproprotein GN=ELANE VNWIDSIIQR 736.9259 2 35919 35923 113.0 127802000.0
상품 미리보기
연락처 및 데이터 관리
판매제공처 홈페이지 판매담당자 연락처 이메일
www.cellkey.co.kr 셀키 0507-1387-0260 sylee@cellkey.co.kr
연관 상품
상품명 가격
폐질환·폐암(편평상피세포암) 환자 의료 및 단백체 데이터 0
폐질환·폐암(선암) 환자 의료 및 단백체 데이터 0
폐질환·폐암(선암) 환자 의료 및 당단백체 데이터 5000000
폐질환·폐암(편평상피세포암) 환자 의료 및 당단백체 데이터 5000000
제약 및 취소환불 규정
제약 및 취소/환불 규정 안내
데이터 상품은 디지털화된 상품의 특성상 반품, 취소, 환불 되지 않으나 데이터의 심각한 오류, 상이한 데이터에 한하여 구매자가 요구하는 경우 환불을 진행할 수 있습니다.
상품 Q&A

※ 본인의 글만 수정이 가능하며, 타인의 글에 댓글을 남길 수 없습니다.
※ 댓글이 달린 글은 수정과 삭제가 불가능합니다.

등록된 글이 없습니다.

닫기버튼
해당 문의 내역을 삭제하시겠습니까?

닫기버튼
해당 문의 내역을 삭제하시겠습니까?